Protein Info for A4249_RS03585 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: isobutyryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF02771: Acyl-CoA_dh_N" amino acids 7 to 116 (110 residues), 120.5 bits, see alignment E=1.2e-38 PF02770: Acyl-CoA_dh_M" amino acids 122 to 215 (94 residues), 91.8 bits, see alignment E=6.5e-30 PF00441: Acyl-CoA_dh_1" amino acids 227 to 376 (150 residues), 178.7 bits, see alignment E=2e-56 PF08028: Acyl-CoA_dh_2" amino acids 244 to 362 (119 residues), 88.2 bits, see alignment E=1.5e-28

Best Hits

Swiss-Prot: 57% identical to ACAD8_DICDI: Isobutyryl-CoA dehydrogenase, mitochondrial (acad8) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 86% identity to bsb:Bresu_1875)

MetaCyc: 44% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

"Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.3.99.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.1

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NDI2 at UniProt or InterPro

Protein Sequence (378 amino acids)

>A4249_RS03585 isobutyryl-CoA dehydrogenase (Brevundimonas sp. GW460-12-10-14-LB2)
MDFALNDDQRAIQDAARAFAEAELAPHSARWDEDKHFPVEVMKQAAEMGFCGIYTGEEHG
GMALGRVEAAVIFEELSRGDVATAAFISIHNMATWMIDRFGSDDLRARFVPDLVGMEKIA
SYCLTEPGSGSDAAALRTTAVRDGDHYVLNGSKAFISGAGTSDVYVVMVRTGGEGAKGVS
AIVVEAGTPGLSFGAQEKKMGWNAQPTAIVQFDDCRVPVANLLGEEGAGFRYAMAGLDGG
RLNIAACSLGGARLALETAQDYVATRKQFGRPIGEFQALQFRLADMATDLEAARLMVLRG
AWAIDTDHPEKTKWCAMAKRLATDACFQIADEALQLHGGYGYLKDYPLERIVRDLRVHRI
LEGTNEIMRVIIAREMTK