Protein Info for A4249_RS03260 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 122 to 138 (17 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 17 to 347 (331 residues), 105.8 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: None (inferred from 48% identity to cak:Caul_2353)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A160HXK4 at UniProt or InterPro

Protein Sequence (386 amino acids)

>A4249_RS03260 acyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MTSVPPTRDGYPADLRALTSLRAFLALGVVLFHYQLQWDPALGFSPIIERSRLAVDAFFM
LSGFILAHVYGPAFASRGFSYRRFIVARLARLYPLHVAVLTGALIMVLGATAAGVRFDAE
GYGPLAFFQTLFLIQAWFPTDAELNWSGPSWSLSAEWFAYLLFPAYAWLALRLRARPWVL
LGIGAAAFVALDAFYVQAFGKVLPRAEDSLGILRIVPEFLVGMALYGLGHRWRWSPPVAA
AAALSTTVLLLGAMQLSLDDRTIVALAAPVILTWSLLARADCEGPLAAPGLVFAGEASFA
LYLVHMPVIVAWKGVVAELRGIDSTFRITPVELIGLFIATALIAAALHLLVEKPGRTWIR
RRFDRRRDELAPAALSPPALREPDDR