Protein Info for A4249_RS02175 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cbb3-type cytochrome c oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 848 transmembrane" amino acids 52 to 73 (22 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 216 to 243 (28 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 373 to 395 (23 residues), see Phobius details amino acids 407 to 431 (25 residues), see Phobius details amino acids 446 to 466 (21 residues), see Phobius details amino acids 487 to 506 (20 residues), see Phobius details amino acids 600 to 622 (23 residues), see Phobius details amino acids 670 to 696 (27 residues), see Phobius details amino acids 708 to 728 (21 residues), see Phobius details amino acids 739 to 760 (22 residues), see Phobius details amino acids 780 to 803 (24 residues), see Phobius details amino acids 821 to 843 (23 residues), see Phobius details PF00115: COX1" amino acids 51 to 496 (446 residues), 483.3 bits, see alignment E=3.6e-149

Best Hits

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 77% identity to pzu:PHZ_c1585)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1) / Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N8K0 at UniProt or InterPro

Protein Sequence (848 amino acids)

>A4249_RS02175 cbb3-type cytochrome c oxidase subunit I (Brevundimonas sp. GW460-12-10-14-LB2)
MSSETGFDPELYKRFPTTEARPEGELEQLDEVWCGPRRPWEWITAINNNYIGVYYVGAAM
LFFVLAGVLALLMRTQLALPMTGFLAQETYNQIFTMHGTVMMFLFAVPAVEALGVLLLPQ
MLGARDLPFPRLSAYAFWAYLVGGLCFFASLFFGLAPNGGWFMYPPLTSTTYSPGINADF
WLLGIGFIEISAIAGAIEIIVGVLKTRAPGMTLDKLPIFAWAMLIFACMIIIAFPSIILS
TLLLELERALGWPFFDAAKGGDPMLWQHLFWFFGHPEVYIIFLPAAGAMSTLIPAVAQTK
LVGYRLVVLAMLATGFISFGVWAHHMFTTGMPQISINYFSAASMAVSVPAGVQVFAWIAT
LAAGKMRFNTPGLFAVGGLVIFVMGGLTGVMVAMVPFDWQAHDSYFIVAHLHYVLIGGMV
FPLFAAIYYWTPMSSSRPLSERWGKWIFWLMFVGHNVTFMPMHLTGLMGMPRRVYTYLPD
RGWDLPNMISTVGSFMFGLAVVLWMIDMIRNFRPFGEKDAGNVFGGPGLEWLPAGRYSLR
SVPVIKSLYPVWDQPNLARDVEAGRYFLPGAPRGERETMITSPINAEPQYLQRMPRPSSW
YVWGAIFTAGFFLILTIQAYVASLVSGVLAVYCILKWCWGLDRPGGPAAVDVGGGVRLPT
YVSGPSSHGWWAMVITLTVSGMVAIMACFSYVFLWSRRPDLWQAPPEIGSLPLTLGLLAA
AGLGAWASQGALKLDRPRSAAIASVLMLVATVAAGGAFASEASAWWNSGLRPDASSQGAT
VYALLAWQGTFVGISLLMGPFVLLRWLCGLVSSRYPATFEVVALFVAFTAVQGAATTLLI
RLFPGVGA