Protein Info for A4249_RS01460 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: signal peptide peptidase SppA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 15 to 550 (536 residues), 340.2 bits, see alignment E=2e-105 PF01343: Peptidase_S49" amino acids 115 to 265 (151 residues), 77.3 bits, see alignment E=6.4e-26 amino acids 367 to 519 (153 residues), 165.4 bits, see alignment E=5.1e-53 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 297 to 518 (222 residues), 171.4 bits, see alignment E=2.1e-54

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 76% identity to bsb:Bresu_2789)

Predicted SEED Role

"Protease IV (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N419 at UniProt or InterPro

Protein Sequence (592 amino acids)

>A4249_RS01460 signal peptide peptidase SppA (Brevundimonas sp. GW460-12-10-14-LB2)
MKQFFLTVLGVFTGLILFVVVIPVVLLTVAVASSSKPTTPATTVLELDLRGGVSDQPSSN
PFAAFGSSGLALTDVVDGLHQAQSDSSVKALLIRLPESGMTPATADELRQAIHRFRNAGK
PVIAHSQGFAPSGAVMSTYMVGASASELWMQNTAGFQATGFSADSLFLGRAFQKYGVKPE
FEQRYEYKNAVNEYTQSDYTGPHREAMTAWMTSIYDTALANAAKDRKTTAPALKTVIEAG
PYSAEQALSNRLIDKVGQVEEAEIAIKTRAGKGAEIVEFGKYASQKGERTGSGKNAIAIV
GGEGAIVTGRGGGASFGGGSSIHSDDTAEAIYDAIEDKSVKAIVFRVSSPGGSPEASEQI
LAAVRAARAAGKPVVVSMGAYAASGGYWISSEADWIVAQPTTLTGSIGVFGGKFVLADAL
GRFGVDMRELTVGGEYADAFSPTQEFTPQQRAAFAGSMDRIYDDFITRVATGRKLSPDRV
REIAKGRVWTGAQALPLGLVDQLGGVTEAVNKARQLAKIPDNEPVRFKHFPKQQSPFEAL
SEMFGVQTEAAKALVMLGGVMADPQAQAVMRRIDSDRMRSQGAVVLADQPVF