Protein Info for A4249_RS00995 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: M48 family metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 35 to 59 (25 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 115 to 140 (26 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details PF16491: Peptidase_M48_N" amino acids 16 to 176 (161 residues), 83.4 bits, see alignment E=1.8e-27 PF01435: Peptidase_M48" amino acids 180 to 385 (206 residues), 88 bits, see alignment E=7.5e-29

Best Hits

KEGG orthology group: K06013, STE24 endopeptidase [EC: 3.4.24.84] (inferred from 62% identity to cak:Caul_2907)

Predicted SEED Role

"peptidase, M48 family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168N0Z2 at UniProt or InterPro

Protein Sequence (401 amino acids)

>A4249_RS00995 M48 family metallopeptidase (Brevundimonas sp. GW460-12-10-14-LB2)
MTNFDPAAATAQWLATLSPQETARAIAYTHGSHWLILWSFLVSALVAWIIVRTGLLVAIR
SRIERRRRRPILASFVVALVYSAMSWALTLPWAIYQGWWREKQYGLTSQALGGWLGEAVI
GAAISVVATSLLLVAIYALIRRARRFWWAWAAGVTAAFIVIGLVLAPLVIEPIFNTYTPA
PNGPVRDAVVTLAKQTGTPSDKIFIYNGSKQSDRYTANVSGLFGTARVAMSDTMFKQGAD
LAEVRGVVGHEMGHYVRAHILWTVGILVLLSVLAFWLTDRLYPVAHRVLRADRVGDISDP
AGLPVLALVLAFLGVLGTPVFATMTRTMEEDADHFSLVHANEPDGLSKALIKTAEYRAPS
PSAIEEFLFYDHPSVENRIRRAMEWKATHPPRDGAQQPTRP