Protein Info for A4249_RS00780 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: transketolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00232: transketolase
  • amino acids 1 to 647 (647 residues), 793 bits, E=1e-242
• PF00456: Transketolase_N
  • amino acids 1 to 320 (320 residues), 423.5 bits, E=1.6e-130
• PF02775: TPP_enzyme_C
  • amino acids 107 to 232 (126 residues), 22.7 bits, E=2.2e-08
• PF00676: E1_dh
  • amino acids 109 to 235 (127 residues), 22.6 bits, E=1.4e-08
• PF02779: Transket_pyr
  • amino acids 341 to 511 (171 residues), 177.3 bits, E=6.9e-56
• PF02780: Transketolase_C
  • amino acids 536 to 641 (106 residues), 51.8 bits, E=2.4e-17

Best Hits

Swiss-Prot: 59% identical to TKT1_XANFL: Transketolase 1 (tkt) from Xanthobacter flavus

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 86% identity to bsb:Bresu_1291)

Predicted SEED Role

"Transketolase (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• pentose phosphate pathway (7/8 steps found)
• Bifidobacterium shunt (12/15 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• oxygenic photosynthesis (11/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of ansamycins
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

See A0A160I2D1 at UniProt or InterPro

Protein Sequence (649 amino acids)

>A4249_RS00780 transketolase (Brevundimonas sp. GW460-12-10-14-LB2)
MANAIRVLAMDGVEKAKSGHPGMPMGMADVATVLFSRFLKFDASRPDWADRDRFILSAGH
GSMLIYALLHLTGYKGATKEELSNFRQWGSKTAGHPEYGHMPGVEVTTGPLGQGLATSVG
FAMAERHLAAKYGDDLVDHRTWVIAGDGCLMEGVSQEAIALAGRYKLNKLHVLWDDNEIT
IDGKVSLSDTTDQKARFKAAGWAVKAIDGHDMNAIKGAMKWAMRQDKPTLIACKTKIGRG
AATMEGSHKTHGAALGAAEIAATRLGLAWDHDPFEMPHTIADAWKKVGRRGAKDRKKWEA
RLAASAKAADFTRAMKGDLPEAAFDALNAKIAELVETQPAQATRQSSGAALDELFAAIPE
LVGGSADLTGSNNTFVKGTPILDAPTYEGRYVNWGIREFGMAAAMNGLALHGGVIPYGGT
FMVFSDYSRPAIRLGALMGVRAIHVLTHDSIGLGEDGPTHQPVEHLAALRAIPNLLVFRP
ADTIEAMECWQIALQTKTAPSALALSRQKTPAVRTVAATENLSAKGAYEIKAANGEAKAT
LFGTGTELALALKAAETLEAEGVATRVVSVPSFELFEQQDAAYQASVIGRGTVRVAVEAA
IKQGWERFIGEDGAFVGMTGFGASAAAEVLYEKFGITSDAIVSAVKARL