Protein Info for A4249_RS00690 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: mitochondrial fission ELM1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF06258: Mito_fiss_Elm1" amino acids 20 to 322 (303 residues), 342.9 bits, see alignment E=7.7e-107

Best Hits

KEGG orthology group: K07276, hypothetical protein (inferred from 69% identity to bsb:Bresu_0981)

Predicted SEED Role

"DUF1022 domain-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MZF1 at UniProt or InterPro

Protein Sequence (326 amino acids)

>A4249_RS00690 mitochondrial fission ELM1 family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MAGAASAQPLSIWVVSDGRAGIENQALGLAEAVQRLTPAEVTIKHTRWRPIFDRLPSALK
IPAMLASAPLTAPWPDLWIATGRATLPLSTRVKAWSGGKTFVVQTQDPRWADDRYDLIVA
PAHDGLSGDNVFEITGSPHRITPQRIAEAAPLFADRIAPLPHPRIAVLIGGKSKAFDLTE
AHAADLADQIADAVRASGGALMLTFSRRTPDAAKAVMTARLSDLPGWIWDGTGDNPLFGF
LHFADHILVTEDSANMAAEAASTGKPVHVLPMIPLKAGDKFARLYDDLQSRGATRPFDGA
LEGWTYDPLAETDRAARAVLEAMQTR