Protein Info for A4249_RS00665 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: PAS domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 PF08447: PAS_3" amino acids 202 to 289 (88 residues), 55.9 bits, see alignment E=1.3e-18 amino acids 338 to 421 (84 residues), 68.2 bits, see alignment E=1.9e-22 PF08448: PAS_4" amino acids 206 to 296 (91 residues), 26.9 bits, see alignment E=1.5e-09 amino acids 321 to 430 (110 residues), 36.3 bits, see alignment E=1.7e-12 TIGR00229: PAS domain S-box protein" amino acids 311 to 433 (123 residues), 53.2 bits, see alignment E=1.6e-18 PF13426: PAS_9" amino acids 326 to 426 (101 residues), 21.1 bits, see alignment E=9.6e-08 PF07536: HWE_HK" amino acids 441 to 529 (89 residues), 52.5 bits, see alignment E=2e-17 PF07568: HisKA_2" amino acids 441 to 514 (74 residues), 28.9 bits, see alignment E=2.9e-10

Best Hits

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168NVM8 at UniProt or InterPro

Protein Sequence (645 amino acids)

>A4249_RS00665 PAS domain-containing protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTHPEVDCPRWDEADRLKALTSYGVLDTTPEGSFDDLASLAARICEAPMAAFSLVDSQRQ
WFKSEVGLGVRETPRPLSFCAHAMLGDDVMVIPDATQDDRFIDNDLVTDAPHIRFYAGYP
LRTPDGVPLGALCVLDDTPRPQGLTELQLMALKTLAQQVMTQLELRRALLDRDLSDRTAR
LAMEASAYVGAWDWDIPENRVIADERFARMYGVDPEAAREGAAIEVFTSSVHPDDAERVA
DEIDQAMTGDGAFVSEYRLGQSDDVRWILARGQVYFDAEGKPIRFPGVAVDITERKTIET
DLAETAVALSESESRFRVLADAMPQMVWSTLPDGFHDYYNARWYEFTGVPLGSTDGEGWN
DMFHADDRERAWTVWRNSLETGEPYEIEYRLKHHSGVYRWTLGRAVAIRDEAGEITRWFG
TLTDIDELKRLEQGRELVSQELSHRIKNIFAVVTALVALSARQYPEAKAFSASLRTRIAA
LARAHEFVRPHTETSKTTIGATTLHSFLSDLFKAYADETGGSRVVIRGEDAVFDDQAATS
VALLFHELATNAAKYGALSERGGVVTLTTERQEDRFVLTWSETGGPVIQGMPQRTGFGSS
LASLSVEGQLGGRLSREWRPEGLQVVVDLPATALSRRRAAGGYSN