Protein Info for A4249_RS00630 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: L-aspartate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00890: FAD_binding_2" amino acids 10 to 378 (369 residues), 269.8 bits, see alignment E=1e-83 PF01266: DAO" amino acids 10 to 179 (170 residues), 32.9 bits, see alignment E=1.1e-11 PF02910: Succ_DH_flav_C" amino acids 454 to 484 (31 residues), 33.3 bits, see alignment (E = 8.6e-12)

Best Hits

Swiss-Prot: 64% identical to NADB_CAUVC: L-aspartate oxidase (nadB) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 69% identity to bsb:Bresu_0966)

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MZ22 at UniProt or InterPro

Protein Sequence (504 amino acids)

>A4249_RS00630 L-aspartate oxidase (Brevundimonas sp. GW460-12-10-14-LB2)
MNRTRHDGPLIVGAGLAGLSAALEAAKAGAKVLVVTPEPLLNACSSAWAQGGMAAALTGQ
DSAALHAKDTEAAGAGLVEPVAARALTEAGRETVEWLAALGAPFDRDADGGFVVSLEAAH
SVPRVARVGGDGAGRAILSAVVAAVRAEKLIEVWDDARLKALSQDADGRVVGAMVVRGDR
LVEITATAVVLATGGAGGLFAATTTPAALKGEGMALAARAGAEILDPEFVQFHPTAIDVG
LDPTPLATEALRGEGARLIDGQGRFLLGEADDADLKPRDVVARAVHAARADGRGAFLDAR
AAIGGEFPHAFPAVFAACMRAGLDPRISPIPVMAACHYHMGGTAADADGRTTVAGLYAVG
ECAATGVHGANRLASNSLLEAAAFGRRAGRSAAQEVGGGRALAADISPDLPDAAMAELRT
AMTAHAGVVRDAEGLQTLISLIDRLQSQHGPAAVLLAARLIAQAALDRRESRGGHYRSDY
PQTDGVAVHTRVRMPYPAALEAAE