Protein Info for A4249_RS00535 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DEAD/DEAH box helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF04851: ResIII" amino acids 19 to 184 (166 residues), 31.8 bits, see alignment E=2e-11 PF00270: DEAD" amino acids 20 to 188 (169 residues), 161.4 bits, see alignment E=2.5e-51 PF00271: Helicase_C" amino acids 226 to 334 (109 residues), 104.6 bits, see alignment E=5.3e-34

Best Hits

KEGG orthology group: K11927, ATP-dependent RNA helicase RhlE [EC: 3.6.4.13] (inferred from 63% identity to pzu:PHZ_c0764)

Predicted SEED Role

"ATP-dependent RNA helicase RhlE" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MYC3 at UniProt or InterPro

Protein Sequence (491 amino acids)

>A4249_RS00535 DEAD/DEAH box helicase (Brevundimonas sp. GW460-12-10-14-LB2)
MGLNKALLQALASTGYTKPTPIQEKAIPDVMAGKDLLGIAQTGTGKTAAFALPILHRLAE
NRIAPKPRTTRVLVLSPTRELATQIGDSFKAYGAHLGFRVAVIFGGVKYGGQERALQQGL
DILVAAPGRLLDHIQQKNLDLSSTEIFVLDEADQMLDLGFIKPIRQIVAKIPAKRQNLFF
SATMPSEIGKLAGELLKDPVKVQVTPQSTTVQRISQSVVYIEQGRKRALLTEMFSDPEYT
RCLVFTKTKHGADKVAAYLEAGGVEAGAIHGNKSQPQRERTLEAFKKGKLRVLVATDIAA
RGIDVDGVSHVVNFELPHVPESYVHRIGRTARAGKDGTAVSFVAGDEMKLLRDIEKVTRQ
KIPAIDRRNDKALGQLDATIMATGVGKKATMPEREGGERNEGGQGRGGRGRRAPHREGVR
PEGGGQPHRQRRNRPGETPAAPRPERAYNPLAGERVPSINDNVKPAEGEMKRRPRRRPSN
GGKGYGGAAKG