Protein Info for A4249_RS00470 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: bifunctional diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 783 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 71 (26 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 172 to 197 (26 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details PF03707: MHYT" amino acids 57 to 108 (52 residues), 54.5 bits, see alignment 1.9e-18 amino acids 118 to 167 (50 residues), 39.5 bits, see alignment 9.4e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 348 to 502 (155 residues), 121.3 bits, see alignment E=1.6e-39 PF00990: GGDEF" amino acids 353 to 502 (150 residues), 133.1 bits, see alignment E=1.6e-42 PF00563: EAL" amino acids 526 to 757 (232 residues), 244.1 bits, see alignment E=2.7e-76

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MXX1 at UniProt or InterPro

Protein Sequence (783 amino acids)

>A4249_RS00470 bifunctional diguanylate cyclase/phosphodiesterase (Brevundimonas sp. GW460-12-10-14-LB2)
MRFFTCLTDDHNLWLVALAAGLCLIGSIITFRLYRRLRAAQKGTRLAWAFMGAVATGATI
WCTHFVAMIAYEPGVTISYGPVLTGLSLGVAIAGSALALWVASRRMPASAEIGGVLFGLT
VVAMHYTGMAAFATDAVIHWSAPYVAASVAGAVVLGALAFNRARQSGKVVPVVLMVMGIV
ALHFTGMAAMTIVPVGALVDMGAVGSTNLVLAFAVSAVGLMMLGTGVASHALDVQSRLQA
KARLDHLIEGSVDGMVVEQDGVILAANAAFADLAGVQHQALVGEPLSRWIAGVADLTVNG
LSQSKLVAEGGADIPVEIAVRRDCGMDHVMIYAVRDLRMRQAQERRIAHLARNDGLTGLP
NRSSFLEWLTRQTADLTVPNKVALLAMDLDRFKEVNDVHGHAAGDQLLIQIAERMRACLR
HDEFIARLGGDEFVAVVPIQHKDDALDLVARLRDAVTAPVVLDHAEVACGLSTGIAIWPD
DAHDPSALINDADLAMYRAKASLGTDVCFYEEEMDEAVRNRRRMAQQMREALDQGQFSLN
WQLQAAVDTGDITGYEVLLRWIQPDGTFISPADFIPLAEENGLILPIGEWVLRTACAEAA
SWTEPHKIAVNLSPVQLGHVDLPRLVHQVLVETGLAPSRLELEITETAMITDMERTTHVL
RQLKLLGVSIAMDDFGTGYSSLSTLRAFPFDKIKLDRSFMSELDGGPQSAAIIRAVLALG
ESLHIPVLAEGVETLEQLAFLRDQGCDEVQGYLLGRPQKTADAEVQAAARVLWAVDPSME
KAA