Protein Info for b3996 in Escherichia coli BW25113

Name: nudC
Annotation: NADH pyrophosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF09297: Zn_ribbon_NUD" amino acids 93 to 124 (32 residues), 39 bits, see alignment 5.3e-14 PF00293: NUDIX" amino acids 132 to 237 (106 residues), 71.1 bits, see alignment E=9.9e-24

Best Hits

Swiss-Prot: 100% identical to NUDC_ECO8A: NADH pyrophosphatase (nudC) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: K03426, NAD+ diphosphatase [EC: 3.6.1.22] (inferred from 100% identity to eco:b3996)

MetaCyc: 100% identical to RNA decapping hydrolase (Escherichia coli K-12 substr. MG1655)
NAD(+) diphosphatase. [EC: 3.6.1.22]; RXN0-7346 [EC: 3.6.1.22]

Predicted SEED Role

"NADH pyrophosphatase (EC 3.6.1.22)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32664 at UniProt or InterPro

Protein Sequence (257 amino acids)

>b3996 NADH pyrophosphatase (NCBI) (Escherichia coli BW25113)
MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLVQQQ
RRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCR
ERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESG
IKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTV
ARRLIEDTVAMCRAEYE