Protein Info for b3838 in Escherichia coli BW25113
Name: tatB
Annotation: sec-independent translocase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to TATB_SHIFL: Sec-independent protein translocase protein TatB (tatB) from Shigella flexneri
KEGG orthology group: K03117, sec-independent protein translocase protein TatB (inferred from 100% identity to eco:b3838)MetaCyc: 100% identical to twin arginine protein translocation system - TatB protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181
Predicted SEED Role
"Twin-arginine translocation protein TatB" in subsystem Twin-arginine translocation system
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P69425 at UniProt or InterPro
Protein Sequence (171 amino acids)
>b3838 sec-independent translocase (NCBI) (Escherichia coli BW25113) MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQ DSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVANDPEKASDEAHTIHNPVVKDNE AAHEGVTPAAAQTQASSPEQKPETTPEPVVKPAADAEPKTAAPSPSSSDKP