Protein Info for b3823 in Escherichia coli BW25113

Name: rhtC
Annotation: threonine efflux system (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 63 (26 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF01810: LysE" amino acids 14 to 205 (192 residues), 204.1 bits, see alignment E=7.8e-65 TIGR00949: homoserine/Threonine efflux protein" amino acids 18 to 202 (185 residues), 236 bits, see alignment E=1.3e-74

Best Hits

Swiss-Prot: 100% identical to RHTC_ECO57: Threonine efflux protein (rhtC) from Escherichia coli O157:H7

KEGG orthology group: K05835, threonine efflux protein (inferred from 100% identity to eco:b3823)

MetaCyc: 100% identical to L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-0244

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AG38 at UniProt or InterPro

Protein Sequence (206 amino acids)

>b3823 threonine efflux system (NCBI) (Escherichia coli BW25113)
MLMLFLTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGIALLGL
HLIIEKMAWLHTLIMVGGGLYLCWMGYQMLRGALKKEAVSAPAPQVELAKSGRSFLKGLL
TNLANPKAIIYFGSVFSLFVGDNVGTTARWGIFALIIVETLAWFTVVASLFALPQMRRGY
QRLAKWIDGFAGALFAGFGIHLIISR