Protein Info for b3424 in Escherichia coli BW25113

Name: glpG
Annotation: predicted intramembrane serine protease (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 96 to 115 (20 residues), see Phobius details amino acids 135 to 160 (26 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 225 to 242 (18 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details PF12122: Rhomboid_N" amino acids 1 to 82 (82 residues), 106 bits, see alignment E=1e-34 TIGR04239: rhomboid family protease GlpG" amino acids 4 to 269 (266 residues), 386.8 bits, see alignment E=3.5e-120 PF01694: Rhomboid" amino acids 133 to 268 (136 residues), 108.8 bits, see alignment E=2.7e-35

Best Hits

Swiss-Prot: 100% identical to GLPG_ECOHS: Rhomboid protease GlpG (glpG) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K02441, GlpG protein (inferred from 100% identity to eco:b3424)

MetaCyc: 100% identical to rhomboid protease GlpG (Escherichia coli K-12 substr. MG1655)
Rhomboid protease. [EC: 3.4.21.105]

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.105

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P09391 at UniProt or InterPro

Protein Sequence (276 amino acids)

>b3424 predicted intramembrane serine protease (NCBI) (Escherichia coli BW25113)
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA
DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM
LWLAWPFDPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI
SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG
WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK