Protein Info for b4539 in Escherichia coli BW25113

Name: yoeB
Annotation: toxin of the YoeB-YefM toxin-antitoxin system (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 84 PF06769: YoeB_toxin" amino acids 5 to 84 (80 residues), 146.1 bits, see alignment E=2.5e-47 TIGR02116: addiction module toxin, Txe/YoeB family" amino acids 5 to 84 (80 residues), 132.6 bits, see alignment E=2.2e-43 PF05016: ParE_toxin" amino acids 12 to 77 (66 residues), 25 bits, see alignment E=2.3e-09

Best Hits

Swiss-Prot: 100% identical to YOEB_SHIFL: Toxin YoeB (yoeB) from Shigella flexneri

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 100% identity to eco:b4539)

MetaCyc: 100% identical to ribosome-dependent mRNA interferase toxin YoeB (Escherichia coli K-12 substr. MG1655)
RXN0-4701

Predicted SEED Role

"YoeB toxin protein"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P69348 at UniProt or InterPro

Protein Sequence (84 amino acids)

>b4539 toxin of the YoeB-YefM toxin-antitoxin system (NCBI) (Escherichia coli BW25113)
MKLIWSEESWDDYLYWQETDKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRI
TEEHRLVYAVTDDSLLIAACRYHY