Protein Info for b4390 in Escherichia coli BW25113

Name: nadR
Annotation: probable nadAB transcriptional regulator (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 PF01381: HTH_3" amino acids 7 to 59 (53 residues), 36.4 bits, see alignment 6.5e-13 TIGR01526: nicotinamide-nucleotide adenylyltransferase" amino acids 64 to 395 (332 residues), 550.4 bits, see alignment E=1.4e-169 TIGR00125: cytidyltransferase-like domain" amino acids 66 to 136 (71 residues), 69.4 bits, see alignment E=2.3e-23 PF13521: AAA_28" amino acids 234 to 394 (161 residues), 115.3 bits, see alignment E=5.3e-37

Best Hits

Swiss-Prot: 100% identical to NADR_ECOLI: Trifunctional NAD biosynthesis/regulator protein NadR (nadR) from Escherichia coli (strain K12)

KEGG orthology group: K06211, HipB family transcriptional regulator, involved in the regulation of NAD biosynthesis (inferred from 100% identity to eco:b4390)

MetaCyc: 100% identical to DNA-binding transcriptional repressor/NMN adenylyltransferase NadR (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide adenylyltransferase. [EC: 2.7.7.1]; Ribosylnicotinamide kinase. [EC: 2.7.7.1, 2.7.1.22]

Predicted SEED Role

"NadR transcriptional regulator / Nicotinamide-nucleotide adenylyltransferase, NadR family (EC 2.7.7.1) / Ribosylnicotinamide kinase (EC 2.7.1.22)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters (EC 2.7.1.22, EC 2.7.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.22 or 2.7.7.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P27278 at UniProt or InterPro

Protein Sequence (410 amino acids)

>b4390 probable nadAB transcriptional regulator (VIMSS) (Escherichia coli BW25113)
MSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFP
RQKKTIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGFDDTRDRALFEDSAMSQQPTV
PDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKKFMAEKGIQPDLIYTSEE
ADAPQYMEHLGIETVLVDPKRTFMSISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVREMMGEQR