Protein Info for b4310 in Escherichia coli BW25113

Name: yjhT
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03547: mutatrotase, YjhT family" amino acids 22 to 359 (338 residues), 479.8 bits, see alignment E=2.5e-148 PF24996: NANM" amino acids 23 to 366 (344 residues), 392.1 bits, see alignment E=4.8e-121 PF24681: Kelch_KLHDC2_KLHL20_DRC7" amino acids 52 to 152 (101 residues), 51.2 bits, see alignment E=2.7e-17 PF01344: Kelch_1" amino acids 74 to 121 (48 residues), 37.3 bits, see alignment 3.9e-13 PF07646: Kelch_2" amino acids 74 to 120 (47 residues), 31.2 bits, see alignment 3.7e-11

Best Hits

Swiss-Prot: 100% identical to NANM_ECOLI: N-acetylneuraminate epimerase (nanM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4310)

MetaCyc: 100% identical to N-acetylneuraminate mutarotase (Escherichia coli K-12 substr. MG1655)
RXN0-5329 [EC: 5.1.3.24]

Predicted SEED Role

"Sialic acid-induced transmembrane protein YjhT(NanM), possible mutarotase" in subsystem Sialic Acid Metabolism

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39371 at UniProt or InterPro

Protein Sequence (368 amino acids)

>b4310 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MNKTITALAIMMASFAANASVLPETPVPFKSGTGAIDNDTVYIGLGSAGTAWYKLDTQAK
DKKWTALAAFPGGPRDQATSAFIDGNLYVFGGIGKNSEGLTQVFNDVHKYNPKTNSWVKL
MSHAPMGMAGHVTFVHNGKAYVTGGVNQNIFNGYFEDLNEAGKDSTAIDKINAHYFDKKA
EDYFFNKFLLSFDPSTQQWSYAGESPWYGTAGAAVVNKGDKTWLINGEAKPGLRTDAVFE
LDFTGNNLKWNKLAPVSSPDGVAGGFAGISNDSLIFAGGAGFKGSRENYQNGKNYAHEGL
KKSYSTDIHLWHNGKWDKSGELSQGRAYGVSLPWNNSLLIIGGETAGGKAVTDSVLITVK
DNKVTVQN