Protein Info for b4307 in Escherichia coli BW25113

Name: yjhQ
Annotation: KpLE2 phage-like element; predicted acetyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF00583: Acetyltransf_1" amino acids 18 to 118 (101 residues), 46 bits, see alignment E=6e-16 PF13508: Acetyltransf_7" amino acids 51 to 132 (82 residues), 36 bits, see alignment E=7.3e-13

Best Hits

Swiss-Prot: 100% identical to YJHQ_ECOLI: Uncharacterized N-acetyltransferase YjhQ (yjhQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4307)

Predicted SEED Role

"PhnO protein" in subsystem Alkylphosphonate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39368 at UniProt or InterPro

Protein Sequence (181 amino acids)

>b4307 KpLE2 phage-like element; predicted acetyltransferase (NCBI) (Escherichia coli BW25113)
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAV
GHILFTRATFKGEMDSPLMHILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLG
HATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTAQPMTLTGHIRCADPDETGAL
T