Protein Info for b4303 in Escherichia coli BW25113

Name: sgcQ
Annotation: KpLE2 phage-like element; predicted nucleoside triphosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 PF03437: BtpA" amino acids 10 to 265 (256 residues), 369.9 bits, see alignment E=3.5e-115 TIGR00259: membrane complex biogenesis protein, BtpA family" amino acids 11 to 268 (258 residues), 409.4 bits, see alignment E=3.1e-127

Best Hits

Swiss-Prot: 100% identical to SGCQ_ECOLI: Putative sgc region protein SgcQ (sgcQ) from Escherichia coli (strain K12)

KEGG orthology group: K06971, (no description) (inferred from 100% identity to eco:b4303)

Predicted SEED Role

"Putative nucleoside triphosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39364 at UniProt or InterPro

Protein Sequence (268 amino acids)

>b4303 KpLE2 phage-like element; predicted nucleoside triphosphatase (NCBI) (Escherichia coli BW25113)
MSWLKEVIGTEKAVIAMCHLRALPGDPSFDAQLGMNWVIDKAWDDLMALQNGGVDAVMFS
NEFSLPYLTKVRPETTAAMARIIGQLMSDIRIPFGVNVLWDPVASFDLAMATGAKFIREI
FTGAYASDFGVWDTNVGETIRHQHRIGAGEVKTLFNIVPEAAVYLGNRDICSIAKSTVFN
NHPDALCVSGLTAGTRTDSALLKRVKETVPDTVVLANTGVCLENVEEQLSIADGCVTATT
FKKDGVFANFVDQARVSQFMEKVHHIRR