Protein Info for b4265 in Escherichia coli BW25113

Name: idnT
Annotation: L-idonate and D-gluconate transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 10 to 37 (28 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 99 to 129 (31 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 350 to 369 (20 residues), see Phobius details amino acids 377 to 394 (18 residues), see Phobius details amino acids 415 to 438 (24 residues), see Phobius details PF02447: GntP_permease" amino acids 1 to 436 (436 residues), 613.4 bits, see alignment E=3.4e-188 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 1 to 438 (438 residues), 660.8 bits, see alignment E=5.6e-203 PF03600: CitMHS" amino acids 15 to 384 (370 residues), 51.3 bits, see alignment E=1.5e-17 PF06808: DctM" amino acids 164 to 378 (215 residues), 25.8 bits, see alignment E=7.1e-10

Best Hits

Swiss-Prot: 100% identical to IDNT_ECOLI: Gnt-II system L-idonate transporter (idnT) from Escherichia coli (strain K12)

KEGG orthology group: K06157, Gnt-II system L-idonate transporter (inferred from 100% identity to eco:b4265)

MetaCyc: 100% identical to L-idonate/5-ketogluconate/gluconate transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-181A; TRANS-RXN0-209; TRANS-RXN0-228

Predicted SEED Role

"L-idonate, D-gluconate, 5-keto-D-gluconate transporter" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39344 at UniProt or InterPro

Protein Sequence (439 amino acids)

>b4265 L-idonate and D-gluconate transporter (NCBI) (Escherichia coli BW25113)
MPLIIIAAGVALLLILMIGFKVNGFIALVLVAAVVGFAEGMDAQAVLHSIQNGIGSTLGG
LAMILGFGAMLGKLISDTGAAQRIATTLIATFGKKRVQWALVITGLVVGLAMFFEVGFVL
LLPLVFTIVASSGLPLLYVGVPMVAALSVTHCFLPPHPGPTAIATIFEANLGTTLLYGFI
ITIPTVIVAGPLFSKLLTRFEKAPPEGLFNPHLFSEEEMPSFWNSIFAAVIPVILMAIAA
VCEITLPKTNTVRLFFEFVGNPAVALFIAIVIAIFTLGRRNGRTIEQIMDIIGDSIGAIA
MIVFIIAGGGAFKQVLVDSGVGHYISHLMTGTTLSPLLMCWTVAALLRIALGSATVAAIT
TAGVVLPIINVTHADPALMVLATGAGSVIASHVNDPGFWLFKGYFNLTVGETLRTWTVME
TLISIMGLLGVLAINAVLH