Protein Info for b4240 in Escherichia coli BW25113

Name: treB
Annotation: fused trehalose(maltose)-specific PTS enzyme: IIB component/IIC component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 108 to 131 (24 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 373 to 391 (19 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details amino acids 438 to 461 (24 residues), see Phobius details TIGR01992: PTS system, trehalose-specific IIBC component" amino acids 8 to 461 (454 residues), 738.4 bits, see alignment E=5.2e-226 PF00367: PTS_EIIB" amino acids 13 to 40 (28 residues), 41.5 bits, see alignment (E = 7.3e-15) TIGR00826: PTS system, glucose-like IIB component" amino acids 31 to 112 (82 residues), 74.3 bits, see alignment E=1.2e-24 PF02378: PTS_EIIC" amino acids 114 to 405 (292 residues), 120.6 bits, see alignment E=7.6e-39 TIGR00852: PTS system, maltose and glucose-specific subfamily, IIC component" amino acids 164 to 448 (285 residues), 292.3 bits, see alignment E=5.9e-91

Best Hits

Swiss-Prot: 100% identical to PTTBC_ECOLI: PTS system trehalose-specific EIIBC component (treB) from Escherichia coli (strain K12)

KEGG orthology group: K02818, PTS system, trehalose-specific IIB component [EC: 2.7.1.69] K02819, PTS system, trehalose-specific IIC component (inferred from 100% identity to eco:b4240)

MetaCyc: 100% identical to trehalose-specific PTS enzyme IIBC component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-168 [EC: 2.7.1.201]

Predicted SEED Role

"PTS system, trehalose-specific IIB component (EC 2.7.1.69) / PTS system, trehalose-specific IIC component (EC 2.7.1.69)" in subsystem Trehalose Uptake and Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.201 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P36672 at UniProt or InterPro

Protein Sequence (473 amino acids)

>b4240 fused trehalose(maltose)-specific PTS enzyme: IIB component/IIC component (NCBI) (Escherichia coli BW25113)
MMSKINQTDIDRLIELVGGRGNIATVSHCITRLRFVLNQPANARPKEIEQLPMVKGCFTN
AGQFQVVIGTNVGDYYQALIASTGQAQVDKEQVKKAARHNMKWHEQLISHFAVIFFPLLP
ALISGGLILGFRNVIGDLPMSNGQTLAQMYPSLQTIYDFLWLIGEAIFFYLPVGICWSAV
KKMGGTPILGIVLGVTLVSPQLMNAYLLGQQLPEVWDFGMFSIAKVGYQAQVIPALLAGL
ALGVIETRLKRIVPDYLYLVVVPVCSLILAVFLAHALIGPFGRMIGDGVAFAVRHLMTGS
FAPIGAALFGFLYAPLVITGVHQTTLAIDLQMIQSMGGTPVWPLIALSNIAQGSAVIGII
ISSRKHNEREISVPAAISAWLGVTEPAMYGINLKYRFPMLCAMIGSGLAGLLCGLNGVMA
NGIGVGGLPGILSIQPSYWQVFALAMAIAIIIPIVLTSFIYQRKYRLGTLDIV