Protein Info for b4218 in Escherichia coli BW25113

Name: ytfL
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 56 to 80 (25 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details PF01595: CNNM" amino acids 7 to 197 (191 residues), 145.7 bits, see alignment E=1.9e-46 PF00571: CBS" amino acids 284 to 333 (50 residues), 19.4 bits, see alignment 1.7e-07 PF03471: CorC_HlyC" amino acids 348 to 424 (77 residues), 78.5 bits, see alignment E=4.6e-26

Best Hits

Swiss-Prot: 100% identical to YTFL_ECOLI: UPF0053 inner membrane protein YtfL (ytfL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4218)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AE45 at UniProt or InterPro

Protein Sequence (447 amino acids)

>b4218 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MLNSILVILCLIAVSAFFSMSEISLAASRKIKLKLLADEGNINAQRVLNMQENPGMFFTV
VQIGLNAVAILGGIVGDAAFSPAFHSLFSRYMSAELSEQLSFILSFSLVTGMFILFADLT
PKRIGMIAPEAVALRIINPMRFCLYVCTPLVWFFNGLANIIFRIFKLPMVRKDDITSDDI
YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTPRENVIWFDLHEDEQSLKNKVAE
HPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLALNSGVQIRNTLIVPDTLTLSEALE
SFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQGLEEQIVARDENSWLIDGGTP
IDDVMRVLDIDEFPQSGNYETIGGFMMFMLRKIPKRTDSVKFAGYKFEVVDIDNYRIDQL
LVTRIDSKATALSPKLPDAKDKEESVA