Protein Info for b4171 in Escherichia coli BW25113

Name: miaA
Annotation: tRNA delta(2)-isopentenylpyrophosphate transferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR00174: tRNA dimethylallyltransferase" amino acids 12 to 300 (289 residues), 417.4 bits, see alignment E=1.5e-129 PF01745: IPT" amino acids 14 to 109 (96 residues), 21.2 bits, see alignment E=1.7e-08 PF01715: IPPT" amino acids 46 to 288 (243 residues), 307.3 bits, see alignment E=8.7e-96

Best Hits

Swiss-Prot: 100% identical to MIAA_ECOHS: tRNA dimethylallyltransferase (miaA) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K00791, tRNA dimethylallyltransferase [EC: 2.5.1.75] (inferred from 100% identity to eco:b4171)

MetaCyc: 100% identical to tRNA dimethylallyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6274 [EC: 2.5.1.75]

Predicted SEED Role

"tRNA dimethylallyltransferase (EC 2.5.1.75)" (EC 2.5.1.75)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P16384 at UniProt or InterPro

Protein Sequence (316 amino acids)

>b4171 tRNA delta(2)-isopentenylpyrophosphate transferase (NCBI) (Escherichia coli BW25113)
MSDISKASLPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAE
ELLAAPHRLLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLS
PLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGK
TLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFEAEVRALFARGDLH
TDLPSIRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKP
EQARDEVLQVVGAIAG