Protein Info for b4146 in Escherichia coli BW25113

Name: yjeK
Annotation: predicted lysine aminomutase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR00238: KamA family protein" amino acids 3 to 328 (326 residues), 527.8 bits, see alignment E=9.3e-163 TIGR03821: EF-P beta-lysylation protein EpmB" amino acids 15 to 335 (321 residues), 533.7 bits, see alignment E=1.4e-164 PF13353: Fer4_12" amino acids 112 to 173 (62 residues), 22.8 bits, see alignment E=1e-08 PF04055: Radical_SAM" amino acids 118 to 263 (146 residues), 36.6 bits, see alignment E=5.3e-13

Best Hits

Swiss-Prot: 100% identical to EPMB_ECOLI: L-lysine 2,3-aminomutase (epmB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4146)

MetaCyc: 100% identical to lysine 2,3-aminomutase (Escherichia coli K-12 substr. MG1655)
5.4.3.-

Predicted SEED Role

"Lysyl-lysine 2,3-aminomutase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39280 at UniProt or InterPro

Protein Sequence (342 amino acids)

>b4146 predicted lysine aminomutase (NCBI) (Escherichia coli BW25113)
MAHIVTLNTPSREDWLTQLADVVTDPDELLRLLNIDAEEKLLAGRSAKKLFALRVPRSFI
DRMEKGNPDDPLLRQVLTSQDEFVIAPGFSTDPLEEQHSVVPGLLHKYHNRALLLVKGGC
AVNCRYCFRRHFPYAENQGNKRNWQTALEYVAAHPELDEMIFSGGDPLMAKDHELDWLLT
QLEAIPHIKRLRIHSRLPIVIPARITEALVECFARSTLQILLVNHINHANEVDETFRQAM
AKLRRVGVTLLNQSVLLRDVNDNAQTLANLSNALFDAGVMPYYLHVLDKVQGAAHFMVSD
DEARQIMRELLTLVSGYLVPKLAREIGGEPSKTPLDLQLRQQ