Protein Info for b4089 in Escherichia coli BW25113

Name: rpiR
Annotation: transcriptional repressor of rpiB expression (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF01418: HTH_6" amino acids 15 to 90 (76 residues), 92.8 bits, see alignment E=1.1e-30 PF01380: SIS" amino acids 138 to 266 (129 residues), 116.7 bits, see alignment E=6.6e-38

Best Hits

Swiss-Prot: 100% identical to RPIR_ECOLI: HTH-type transcriptional regulator RpiR (rpiR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4089)

Predicted SEED Role

"Transcriptional regulator of D-allose utilization, RpiR family" in subsystem D-allose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACS7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>b4089 transcriptional repressor of rpiB expression (VIMSS) (Escherichia coli BW25113)
MSQSEFDSALPNGIGLAPYLRMKQEGMTENESRIVEWLLKPGNLSCAPAIKDVAEALAVS
EAMIVKVSKLLGFSGFRNLRSALEDYFSQSEQVLPSELAFDEAPQDVVNKVFNITLRTIM
EGQSIVNVDEIHRAARFFYQARQRDLYGAGGSNAICADVQHKFLRIGVRCQAYPDAHIMM
MSASLLQEGDVVLVVTHSGRTSDVKAAVELAKKNGAKIICITHSYHSPIAKLADYIICSP
APETPLLGRNASARILQLTLLDAFFVSVAQLNIEQANINMQKTGAIVDFFSPGALK