Protein Info for b4083 in Escherichia coli BW25113

Name: yjcS
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 661 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00753: Lactamase_B" amino acids 130 to 355 (226 residues), 94.9 bits, see alignment E=9.5e-31 PF14863: Alkyl_sulf_dimr" amino acids 392 to 530 (139 residues), 189.5 bits, see alignment E=5.6e-60 PF14864: Alkyl_sulf_C" amino acids 539 to 660 (122 residues), 126.5 bits, see alignment E=1.1e-40

Best Hits

Swiss-Prot: 100% identical to YJCS_ECOLI: Putative alkyl/aryl-sulfatase YjcS (yjcS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4083)

MetaCyc: 100% identical to linear primary-alkylsulfatase (Escherichia coli K-12 substr. MG1655)
RXN-15761 [EC: 3.1.6.21]

Predicted SEED Role

"FIG00638848: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.6.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32717 at UniProt or InterPro

Protein Sequence (661 amino acids)

>b4083 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MNNSRLFRLSRIVIALTAASGMMVNTANAKEEAKAATQYTQQVNQNYAKSLPFSDRQDFD
DAQRGFIAPLLDEGILRDANGKVYYRADDYKFDINAAAPETVNPSLWRQSQINGISGLFK
VTDKMYQVRGQDISNITFVEGEKGIIVIDPLVTPPAAKAALDLYFQHRPQKPIVAVIYTH
SHTDHYGGVKGIISEADVKSGKVQVIAPAGFMDEAISENVLAGNIMSRRALYSYGLLLPH
NAQGNVGNGLGVTLATGDPSIIAPTKTIVRTGEKMIIDGLEFDFLMTPGSEAPAEMHFYI
PALKALCTAENATHTLHNFYTLRGAKTRDTSKWTEYLNETLDMWGNDAEVLFMPHTWPVW
GNKHINDYIGKYRDTIKYIHDQTLHLANQGYTMNEIGDMIKLPPALANNWASRGYYGSVS
HNARAVYNFYLGYYDGNPANLHPYGQVEMGKRYVQALGGSARVINLAQEANKQGDYRWSA
ELLKQVIAANPGDQVAKNLQANNFEQLGYQAESATWRGFYLTGAKELREGVHKFSHGTTG
SPDTIRGMSVEMLFDFMAVRLDSAKAAGKNISLNFNMSNGDNLNLTLNDSVLNYRKTLQP
QADASFYISREDLHAVLTGQAKMADLVKAKKAKIIGNGAKLEEIIACLDNFDLWVNIVTP
N