Protein Info for b4040 in Escherichia coli BW25113

Name: ubiA
Annotation: 4-hydroxybenzoate octaprenyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 99 to 132 (34 residues), see Phobius details amino acids 149 to 161 (13 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 236 to 252 (17 residues), see Phobius details amino acids 271 to 288 (18 residues), see Phobius details TIGR01474: 4-hydroxybenzoate polyprenyl transferase" amino acids 11 to 287 (277 residues), 372.2 bits, see alignment E=9.1e-116 PF01040: UbiA" amino acids 28 to 271 (244 residues), 246 bits, see alignment E=1.8e-77

Best Hits

Swiss-Prot: 100% identical to UBIA_ECOL5: 4-hydroxybenzoate octaprenyltransferase (ubiA) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 100% identity to eco:b4040)

MetaCyc: 100% identical to 4-hydroxybenzoate octaprenyltransferase (Escherichia coli K-12 substr. MG1655)
4-hydroxybenzoate nonaprenyltransferase. [EC: 2.5.1.39]

Predicted SEED Role

"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AGK1 at UniProt or InterPro

Protein Sequence (290 amino acids)

>b4040 4-hydroxybenzoate octaprenyltransferase (NCBI) (Escherichia coli BW25113)
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR
AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL
LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA
VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY
WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF