Protein Info for b4039 in Escherichia coli BW25113

Name: ubiC
Annotation: chorismate lyase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04345: Chor_lyase
  • amino acids 17 to 165 (149 residues), 106.7 bits, E=5.2e-35

Best Hits

Swiss-Prot: 100% identical to UBIC_ECOLI: Chorismate pyruvate-lyase (ubiC) from Escherichia coli (strain K12)

KEGG orthology group: K03181, chorismate--pyruvate lyase [EC: 4.1.3.40] (inferred from 100% identity to eco:b4039)

MetaCyc: 100% identical to chorismate lyase (Escherichia coli K-12 substr. MG1655)
Chorismate lyase. [EC: 4.1.3.40]

Predicted SEED Role

"Chorismate--pyruvate lyase (EC 4.1.3.40)" in subsystem Ubiquinone Biosynthesis (EC 4.1.3.40)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• 4-hydroxybenzoate biosynthesis II (bacteria) (1/1 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• polybrominated phenols biosynthesis (1/4 steps found)
• spongiadioxin C biosynthesis (1/7 steps found)
• polybrominated dihydroxylated diphenyl ethers biosynthesis (1/8 steps found)
• p-HBAD biosynthesis (1/9 steps found)
• tetrahydromethanopterin biosynthesis (3/14 steps found)
• superpathway of polybrominated aromatic compound biosynthesis (2/20 steps found)
• phenolphthiocerol biosynthesis (1/23 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40

Sequence Analysis Tools

See P26602 at UniProt or InterPro

Protein Sequence (165 amino acids)

>b4039 chorismate lyase (VIMSS) (Escherichia coli BW25113)
MSHPALTQLRALRYCKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNE
IPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLF
TSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY