Protein Info for b4034 in Escherichia coli BW25113

Name: malE
Annotation: maltose ABC transporter periplasmic protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01547: SBP_bac_1" amino acids 46 to 314 (269 residues), 157.3 bits, see alignment E=9.7e-50 PF13416: SBP_bac_8" amino acids 50 to 344 (295 residues), 140.3 bits, see alignment E=1.1e-44

Best Hits

Swiss-Prot: 100% identical to MALE_ECO57: Maltose/maltodextrin-binding periplasmic protein (malE) from Escherichia coli O157:H7

KEGG orthology group: K10108, maltose/maltodextrin transport system substrate-binding protein (inferred from 100% identity to eco:b4034)

MetaCyc: 100% identical to maltose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-16-RXN [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE" in subsystem Bacterial Chemotaxis or Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AEX9 at UniProt or InterPro

Protein Sequence (396 amino acids)

>b4034 maltose ABC transporter periplasmic protein (NCBI) (Escherichia coli BW25113)
MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK
VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTW
DAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEP
YFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAE
AAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKE
LAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIP
QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK