Protein Info for b4024 in Escherichia coli BW25113

Name: lysC
Annotation: aspartate kinase III (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 TIGR00656: aspartate kinase, monofunctional class" amino acids 3 to 449 (447 residues), 511.4 bits, see alignment E=1.9e-157 TIGR00657: aspartate kinase" amino acids 3 to 449 (447 residues), 465 bits, see alignment E=2.9e-143 PF00696: AA_kinase" amino acids 4 to 277 (274 residues), 158 bits, see alignment E=6.6e-50 PF22468: ACT_9" amino acids 389 to 446 (58 residues), 50.8 bits, see alignment 2.3e-17

Best Hits

Swiss-Prot: 100% identical to AK3_ECOLI: Lysine-sensitive aspartokinase 3 (lysC) from Escherichia coli (strain K12)

KEGG orthology group: K00928, aspartate kinase [EC: 2.7.2.4] (inferred from 100% identity to eco:b4024)

MetaCyc: 100% identical to aspartate kinase III (Escherichia coli K-12 substr. MG1655)
Aspartate kinase. [EC: 2.7.2.4]

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.4

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P08660 at UniProt or InterPro

Protein Sequence (449 amino acids)

>b4024 aspartate kinase III (NCBI) (Escherichia coli BW25113)
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE