Protein Info for b3998 in Escherichia coli BW25113

Name: nfi
Annotation: endonuclease V (deoxyinosine 3'endoduclease) (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF04493: Endonuclease_5" amino acids 12 to 206 (195 residues), 254.7 bits, see alignment E=3e-80

Best Hits

Swiss-Prot: 100% identical to NFI_ECOK1: Endonuclease V (nfi) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K05982, deoxyribonuclease V [EC: 3.1.21.7] (inferred from 100% identity to eco:b3998)

MetaCyc: 100% identical to endonuclease V (Escherichia coli K-12 substr. MG1655)
Deoxyribonuclease V. [EC: 3.1.21.7]

Predicted SEED Role

"Endonuclease V (EC 3.1.21.7)" in subsystem DNA repair, bacterial (EC 3.1.21.7)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P68739 at UniProt or InterPro

Protein Sequence (223 amino acids)

>b3998 endonuclease V (deoxyinosine 3'endoduclease) (VIMSS) (Escherichia coli BW25113)
MDLASLRAQQIELASSVIREDRLDKDPPDLIAGADVGFEQGGEVTRAAMVLLKYPSLELV
EYKVARIATTMPYIPGFLSFREYPALLAAWEMLSQKPDLVFVDGHGISHPRRLGVASHFG
LLVDVPTIGVAKKRLCGKFEPLSSEPGALAPLMDKGEQLAWVWRSKARCNPLFIATGHRV
SVDSALAWVQRCMKGYRLPEPTRWADAVASERPAFVRYTANQP