Protein Info for b3991 in Escherichia coli BW25113

Name: thiG
Annotation: thiamin biosynthesis, thiazole moiety (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF05690: ThiG" amino acids 4 to 247 (244 residues), 373.7 bits, see alignment E=1.9e-116

Best Hits

Swiss-Prot: 100% identical to THIG_ECOBW: Thiazole synthase (thiG) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 100% identity to eco:b3991)

MetaCyc: 100% identical to 1-deoxy-D-xylulose 5-phosphate:thiol sulfurtransferase (Escherichia coli K-12 substr. MG1655)
THIAZOLSYN2-RXN [EC: 2.8.1.10]

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P30139 at UniProt or InterPro

Protein Sequence (256 amino acids)

>b3991 thiamin biosynthesis, thiazole moiety (VIMSS) (Escherichia coli BW25113)
MLRIADKTFDSHLFTGTGKFASSQLMVEAIRASGSQLVTLAMKRVDLRQHNDAILEPLIA
AGVTLLPNTSGAKTAEEAIFAAHLAREALGTNWLKLEIHPDARWLLPDPIETLKAAETLV
QQGFVVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLETRAMLEIIIQQATVPVVV
DAGIGVPSHAAQALEMGADAVLVNTAIAVADDPVNMAKAFRLAVEAGLLARQSGPGSRSY
FAHATSPLTGFLEASA