Protein Info for b3963 in Escherichia coli BW25113

Name: fabR
Annotation: DNA-binding transcriptional repressor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF00440: TetR_N" amino acids 22 to 58 (37 residues), 33.8 bits, see alignment 2.3e-12 PF21943: TetR_C_46" amino acids 87 to 186 (100 residues), 44.6 bits, see alignment E=1.5e-15

Best Hits

Swiss-Prot: 100% identical to FABR_SHIDS: HTH-type transcriptional repressor FabR (fabR) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: None (inferred from 100% identity to eco:b3963)

Predicted SEED Role

"Unsaturated fatty acid biosythesis repressor FabR, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACU5 at UniProt or InterPro

Protein Sequence (215 amino acids)

>b3963 DNA-binding transcriptional repressor (RefSeq) (Escherichia coli BW25113)
MGVRAQQKEKTRRSLVEAAFSQLSAERSFASLSLREVAREAGIAPTSFYRHFRDVDELGL
TMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGNNPNAFRLLLRERSGTSAAF
RAAVAREIQHFIAELADYLELENHMPRAFTEAQAEAMVTIVFSAGAEALDVGVEQRRQLE
ERLVLQLRMISKGAYYWYRREQEKTAIIPGNVKDE