Protein Info for b3959 in Escherichia coli BW25113

Name: argB
Annotation: acetylglutamate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR00761: acetylglutamate kinase" amino acids 5 to 234 (230 residues), 261.3 bits, see alignment E=3.7e-82 PF00696: AA_kinase" amino acids 5 to 235 (231 residues), 149.1 bits, see alignment E=9e-48

Best Hits

Swiss-Prot: 100% identical to ARGB_ECOK1: Acetylglutamate kinase (argB) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K00930, acetylglutamate/acetylaminoadipate kinase [EC: 2.7.2.- 2.7.2.8] (inferred from 100% identity to eco:b3959)

MetaCyc: 100% identical to acetylglutamate kinase (Escherichia coli K-12 substr. MG1655)
Acetylglutamate kinase. [EC: 2.7.2.8]

Predicted SEED Role

"Acetylglutamate kinase (EC 2.7.2.8)" in subsystem Arginine Biosynthesis extended (EC 2.7.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.- or 2.7.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A6C8 at UniProt or InterPro

Protein Sequence (258 amino acids)

>b3959 acetylglutamate kinase (RefSeq) (Escherichia coli BW25113)
MMNPLIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGLNLPVK
KKNGLRVTPADQIDIITGALAGTANKTLLAWAKKHQIAAVGLFLGDGDSVKVTQLDEELG
HVGLAQPGSPKLINSLLENGYLPVVSSIGVTDEGQLMNVNADQAATALAATLGADLILLS
DVSGILDGKGQRIAEMTAAKAEQLIEQGIITDGMIVKVNAALDAARTLGRPVDIASWRHA
EQLPALFNGMPMGTRILA