Protein Info for b3936 in Escherichia coli BW25113

Name: rpmE
Annotation: 50S ribosomal subunit protein L31 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 70 PF01197: Ribosomal_L31" amino acids 1 to 65 (65 residues), 110.5 bits, see alignment E=1.8e-36 TIGR00105: ribosomal protein bL31" amino acids 1 to 66 (66 residues), 117 bits, see alignment E=1.5e-38

Best Hits

Swiss-Prot: 100% identical to RL31_SHIBS: 50S ribosomal protein L31 (rpmE) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K02909, large subunit ribosomal protein L31 (inferred from 100% identity to eco:b3936)

MetaCyc: 100% identical to 50S ribosomal subunit protein L31 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A7M9 at UniProt or InterPro

Protein Sequence (70 amino acids)

>b3936 50S ribosomal subunit protein L31 (NCBI) (Escherichia coli BW25113)
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRF
NKRFNIPGSK