Protein Info for b3897 in Escherichia coli BW25113

Name: frvR
Annotation: predicted regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 PF08279: HTH_11" amino acids 5 to 60 (56 residues), 38.9 bits, see alignment 1e-13 PF00359: PTS_EIIA_2" amino acids 455 to 560 (106 residues), 51 bits, see alignment E=2.3e-17

Best Hits

Swiss-Prot: 100% identical to FRVR_ECOLI: Putative frv operon regulatory protein (frvR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3897)

Predicted SEED Role

"Putative frv operon regulatory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32152 at UniProt or InterPro

Protein Sequence (582 amino acids)

>b3897 predicted regulator (NCBI) (Escherichia coli BW25113)
MLNERQLKIVDLLEQQPRTPGELAQQTGVSGRTILRDIDYLNFTLNGKARIFASGSAGYQ
LEIFERRSFFQLLQKHDNDDRLLALLLLNTFTPRAQLASALNLPETWVAERLPRLKQRYE
RTCCLASRPGLGHFIDETEEKRVILLANLLRKDPFLIPLAGITRDNLQHLSTACDNQHRW
PLMQGDYLSSLILAIYALRNQLTDEWPQYPGDEIKQIVEHSGLFLGDNAVRTLTGLIEKQ
HQQAQVISADNVQGLLQRVPGIASLNIIDAQLVENITGHLLRCLAAPVWIAEHRQSSMNN
LKAAWPAAFDMSLHFITLLREQLDIPLFDSDLIGLYFACALERHQNERQPIILLSDQNAI
ATINQLAIERDVLNCRVIIARSLSELVAIREEIEPLLIINNSHYLLDDAVNNYITVKNII
TAAGIEQIKHFLATAFIRQQPERFFSAPGSFHYSNVRGESWQHITRQICAQLVAQHHITA
DEAQRIIAREGEGENLIVNRLAIPHCWSEQERRFRGFFITLAQPVEVNNEVINHVLIACA
AADARHELKIFSYLASILCQHPAEIIAGLTGYEAFMELLHKG