Protein Info for b3895 in Escherichia coli BW25113

Name: fdhD
Annotation: formate dehydrogenase accessory protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR00129: formate dehydrogenase family accessory protein FdhD" amino acids 34 to 277 (244 residues), 339.8 bits, see alignment E=3.9e-106 PF02634: FdhD-NarQ" amino acids 38 to 275 (238 residues), 241.9 bits, see alignment E=4e-76

Best Hits

Swiss-Prot: 100% identical to FDHD_SHISS: Sulfur carrier protein FdhD (fdhD) from Shigella sonnei (strain Ss046)

KEGG orthology group: K02379, FdhD protein (inferred from 100% identity to eco:b3895)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P32177 at UniProt or InterPro

Protein Sequence (277 amino acids)

>b3895 formate dehydrogenase accessory protein (NCBI) (Escherichia coli BW25113)
MKKTQRKEIENVTNITGVRQIELWRRDDLQHPRLDEVAEEVPVALVYNGISHVVMMASPK
DLEYFALGFSLSEGIIESPRDIFGMDVVPSCNGLEVQIELSSRRFMGLKERRRALAGRTG
CGVCGVEQLNDIGKPVQPLPFTQTFDLNKLDDALRHLNDFQPVGQLTGCTHAAAWMLPSG
ELVGGHEDVGRHVALDKLLGRRSQEGESWQQGAVLVSSRASYEMVQKSAMCGVEILFAVS
AATTLAVEVAERCNLTLVGFCKPGRATVYTHPQRLSN