Protein Info for b3886 in Escherichia coli BW25113

Name: rbn
Annotation: ribonuclease BN (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 240 to 268 (29 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 18 to 275 (258 residues), 352.9 bits, see alignment E=6.7e-110 PF03631: Virul_fac_BrkB" amino acids 29 to 274 (246 residues), 203.3 bits, see alignment E=2.8e-64

Best Hits

Swiss-Prot: 100% identical to YIHY_ECOSM: UPF0761 membrane protein YihY (yihY) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to eco:b3886)

Predicted SEED Role

"Inner membrane protein YihY, formerly thought to be RNase BN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A8K8 at UniProt or InterPro

Protein Sequence (290 amino acids)

>b3886 ribonuclease BN (NCBI) (Escherichia coli BW25113)
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA
FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI
DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV
LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL
IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP