Protein Info for b3883 in Escherichia coli BW25113

Name: yihV
Annotation: putative kinase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00294: PfkB
  • amino acids 1 to 286 (286 residues), 235 bits, E=6.3e-74

Best Hits

Swiss-Prot: 100% identical to SQUV_ECOLI: Sulfofructose kinase (yihV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3883)

MetaCyc: 100% identical to 6-deoxy-6-sulfofructose kinase (Escherichia coli K-12 substr. MG1655)
RXN-15297 [EC: 2.7.1.184]

Predicted SEED Role

"Fructokinase (EC 2.7.1.4); Sugar kinase YihV" (EC 2.7.1.4)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (17/19 steps found)
• heterolactic fermentation (16/18 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• D-sorbitol degradation I (3/3 steps found)
• mannitol cycle (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• sulfoquinovose degradation I (4/5 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• sulfoquinovose degradation VI (3/5 steps found)
• sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.4

Use Curated BLAST to search for 2.7.1.184 or 2.7.1.4

Sequence Analysis Tools

See P32143 at UniProt or InterPro

Protein Sequence (298 amino acids)

>b3883 putative kinase (VIMSS) (Escherichia coli BW25113)
MIRVACVGITVMDRIYYVEGLPTESGKYVARNYTEVGGGPAATAAVAAARLGAQVDFIGR
VGDDDTGNSLLAELESWGVNTRYTKRYNQAKSSQSAIMVDTKGERIIINYPSPDLLPDAE
WLEEIDFSQWDVVLADVRWHDGAKKAFTLARQAGVMTVLDGDITPQDISELVALSDHAAF
SEPGLARLTGVKEMASALKQAQTLTNGHVYVTQGSAGCDWLENGGRQHQPAFKVDVVDTT
GAGDVFHGALAVALATSGDLAESVRFASGVAALKCTRPGGRAGIPDCDQTRSFLSLFV