Protein Info for b3744 in Escherichia coli BW25113

Name: asnA
Annotation: asparagine synthetase AsnA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00669: aspartate--ammonia ligase
  • amino acids 1 to 330 (330 residues), 665 bits, E=1.1e-204
• PF03590: AsnA
  • amino acids 9 to 244 (236 residues), 308.2 bits, E=2.1e-96

Best Hits

Swiss-Prot: 100% identical to ASNA_ECOBW: Aspartate--ammonia ligase (asnA) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K01914, aspartate--ammonia ligase [EC: 6.3.1.1] (inferred from 100% identity to eco:b3744)

MetaCyc: 100% identical to asparagine synthetase A (Escherichia coli K-12 substr. MG1655)
Aspartate--ammonia ligase. [EC: 6.3.1.1]

Predicted SEED Role

"Aspartate--ammonia ligase (EC 6.3.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 6.3.1.1)

MetaCyc Pathways

• superpathway of L-aspartate and L-asparagine biosynthesis (4/4 steps found)
• superpathway of L-asparagine biosynthesis (2/2 steps found)
• L-asparagine biosynthesis II (1/1 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Cyanoamino acid metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.1

Sequence Analysis Tools

See P00963 at UniProt or InterPro

Protein Sequence (330 amino acids)

>b3744 asparagine synthetase AsnA (NCBI) (Escherichia coli BW25113)
MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGCEKAVQVKVK
ALPDAQFEVVHSLAKWKRQTLGQHDFSAGEGLYTHMKALRPDEDRLSPLHSVYVDQWDWE
RVMGDGERQFSTLKSTVEAIWAGIKATEAAVSEEFGLAPFLPDQIHFVHSQELLSRYPDL
DAKGRERAIAKDLGAVFLVGIGGKLSDGHRHDVRAPDYDDWSTPSELGHAGLNGDILVWN
PVLEDAFELSSMGIRVDADTLKHQLALTGDEDRLELEWHQALLRGEMPQTIGGGIGQSRL
TMLLLQLPHIGQVQCGVWPAAVRESVPSLL