Protein Info for b3743 in Escherichia coli BW25113
Name: asnC
Annotation: DNA-binding transcriptional dual regulator (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ASNC_SHIFL: Regulatory protein AsnC (asnC) from Shigella flexneri
KEGG orthology group: K03718, Lrp/AsnC family transcriptional regulator, regulator for asnA, asnC and gidA (inferred from 100% identity to eco:b3743)Predicted SEED Role
"Regulatory protein AsnC"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0ACI6 at UniProt or InterPro
Protein Sequence (152 amino acids)
>b3743 DNA-binding transcriptional dual regulator (NCBI) (Escherichia coli BW25113) MENYLIDNLDRGILEALMGNARTAYAELAKQFGVSPGTIHVRVEKMKQAGIITGARIDVS PKQLGYDVGCFIGIILKSAKDYPSALAKLESLDEVTEAYYTTGHYSIFIKVMCRSIDALQ HVLINKIQTIDEIQSTETLIVLQNPIMRTIKP