Protein Info for b3732 in Escherichia coli BW25113

Name: atpD
Annotation: F0F1 ATP synthase subunit beta (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 TIGR01039: ATP synthase F1, beta subunit" amino acids 3 to 460 (458 residues), 875.2 bits, see alignment E=5e-268 PF02874: ATP-synt_ab_N" amino acids 6 to 72 (67 residues), 67.3 bits, see alignment E=2.2e-22 PF00006: ATP-synt_ab" amino acids 130 to 342 (213 residues), 241 bits, see alignment E=1.7e-75 PF22919: ATP-synt_VA_C" amino acids 349 to 437 (89 residues), 63.6 bits, see alignment E=2.3e-21

Best Hits

Swiss-Prot: 100% identical to ATPB_ECO81: ATP synthase subunit beta (atpD) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 100% identity to eco:b3732)

MetaCyc: 100% identical to ATP synthase F1 complex subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ABB4 at UniProt or InterPro

Protein Sequence (460 amino acids)

>b3732 F0F1 ATP synthase subunit beta (NCBI) (Escherichia coli BW25113)
MATGKIVQVIGAVVDVEFPQDAVPRVYDALEVQNGNERLVLEVQQQLGGGIVRTIAMGSS
DGLRRGLDVKDLEHPIEVPVGKATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEEL
SNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGV
GERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLL
FVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVP
ADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARG
VQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVS
LKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAKKL