Protein Info for b3704 in Escherichia coli BW25113

Name: rnpA
Annotation: ribonuclease P (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00188: ribonuclease P protein component
  • amino acids 5 to 115 (111 residues), 127.2 bits, E=1.7e-41
• PF00825: Ribonuclease_P
  • amino acids 6 to 111 (106 residues), 116.1 bits, E=4e-38

Best Hits

Swiss-Prot: 100% identical to RNPA_ECOK1: Ribonuclease P protein component (rnpA) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K03536, ribonuclease P protein component [EC: 3.1.26.5] (inferred from 100% identity to eco:b3704)

MetaCyc: 100% identical to RNase P protein component (Escherichia coli K-12 substr. MG1655)
Ribonuclease P. [EC: 3.1.26.5]; 3.1.26.5 [EC: 3.1.26.5]

Predicted SEED Role

"Ribonuclease P protein component (EC 3.1.26.5)" in subsystem tRNA processing (EC 3.1.26.5)

MetaCyc Pathways

• tRNA processing (10/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.5

Sequence Analysis Tools

See P0A7Y8 at UniProt or InterPro

Protein Sequence (119 amino acids)

>b3704 ribonuclease P (NCBI) (Escherichia coli BW25113)
MVKLAFPRELRLLTPSQFTFVFQQPQRAGTPQITILGRLNSLGHPRIGLTVAKKNVRRAH
ERNRIKRLTRESFRLRQHELPAMDFVVVAKKGVADLDNRALSEALEKLWRRHCRLARGS