Protein Info for b3697 in Escherichia coli BW25113

Name: yidA
Annotation: predicted hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF00702: Hydrolase" amino acids 3 to 232 (230 residues), 44 bits, see alignment E=5.4e-15 PF05116: S6PP" amino acids 4 to 111 (108 residues), 24.8 bits, see alignment E=2.3e-09 amino acids 176 to 244 (69 residues), 32.7 bits, see alignment E=9.1e-12 TIGR01484: HAD hydrolase, family IIB" amino acids 5 to 237 (233 residues), 108.6 bits, see alignment E=4.7e-35 TIGR00099: Cof-like hydrolase" amino acids 5 to 264 (260 residues), 255.7 bits, see alignment E=5.1e-80 PF08282: Hydrolase_3" amino acids 6 to 264 (259 residues), 227 bits, see alignment E=5.2e-71

Best Hits

Swiss-Prot: 100% identical to YIDA_ECOLI: Sugar phosphatase YidA (yidA) from Escherichia coli (strain K12)

KEGG orthology group: K07024, (no description) (inferred from 100% identity to eco:b3697)

MetaCyc: 100% identical to sugar phosphatase YidA (Escherichia coli K-12 substr. MG1655)
Sugar-phosphatase. [EC: 3.1.3.23]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.23

Use Curated BLAST to search for 3.1.3.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A8Y5 at UniProt or InterPro

Protein Sequence (270 amino acids)

>b3697 predicted hydrolase (NCBI) (Escherichia coli BW25113)
MAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYLKELHME
QPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANR
DISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTV
LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAMDNA
IPSVKEVANFVTKSNLEDGVAFAIEKYVLN