Protein Info for b3676 in Escherichia coli BW25113

Name: yidH
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details PF02656: DUF202" amino acids 13 to 80 (68 residues), 68.6 bits, see alignment E=2.6e-23

Best Hits

Swiss-Prot: 100% identical to YIDH_ECOL6: Inner membrane protein YidH (yidH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00389, putative membrane protein (inferred from 100% identity to eco:b3676)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ADM0 at UniProt or InterPro

Protein Sequence (115 amino acids)

>b3676 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLC
LFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG