Protein Info for b3659 in Escherichia coli BW25113

Name: setC
Annotation: predicted sugar efflux system (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 314 to 331 (18 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details TIGR00899: sugar efflux transporter" amino acids 18 to 393 (376 residues), 646.2 bits, see alignment E=8.2e-199 PF07690: MFS_1" amino acids 20 to 357 (338 residues), 131.8 bits, see alignment E=3e-42 PF12832: MFS_1_like" amino acids 63 to 341 (279 residues), 36.1 bits, see alignment E=4.3e-13

Best Hits

Swiss-Prot: 100% identical to SETC_ECOLI: Sugar efflux transporter C (setC) from Escherichia coli (strain K12)

KEGG orthology group: K03291, MFS transporter, SET family, sugar efflux transporter (inferred from 100% identity to eco:b3659)

MetaCyc: 71% identical to sugar exporter SetB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-82

Predicted SEED Role

"Sugar efflux transporter B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P31436 at UniProt or InterPro

Protein Sequence (394 amino acids)

>b3659 predicted sugar efflux system (NCBI) (Escherichia coli BW25113)
MQKTATTPSKILDLTAAAFLLVAFLTGIAGALQTPTLSIFLADELKARPIMVGFFFTGSA
IMGILVSQFLARHSDKQGDRKLLILLCCLFGVLACTLFAWNRNYFILLSTGVLLSSFAST
ANPQMFALAREHADRTGRETVMFSTFLRAQISLAWVIGPPLAYELAMGFSFKVMYLTAAI
AFVVCGLIVWLFLPSIQRNIPVVTQPVEILPSTHRKRDTRLLFVVCSMMWAANNLYMINM
PLFIIDELHLTDKLTGEMIGIAAGLEIPMMLIAGYYMKRIGKRLLMLIAIVSGMCFYASV
LMATTPAVELELQILNAIFLGILCGIGMLYFQDLMPEKIGSATTLYANTSRVGWIIAGSV
DGIMVEIWSYHALFWLAIGMLGIAMICLLFIKDI