Protein Info for b3618 in Escherichia coli BW25113

Name: htrL
Annotation: involved in lipopolysaccharide biosynthesis (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR02192: protein YibB" amino acids 1 to 277 (277 residues), 443.3 bits, see alignment E=1.9e-137 PF09612: HtrL_YibB" amino acids 3 to 268 (266 residues), 435.7 bits, see alignment E=3.7e-135

Best Hits

Swiss-Prot: 100% identical to HTRL_ECOLI: Protein HtrL (htrL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3618)

Predicted SEED Role

"Involved in lipopolysaccharide biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P25666 at UniProt or InterPro

Protein Sequence (285 amino acids)

>b3618 involved in lipopolysaccharide biosynthesis (VIMSS) (Escherichia coli BW25113)
MKSSTTIITAYFDIGRGDWTANKGFREKLARSVDVYFSYFERLAALENEMIIFTSPDLKP
RVEAIRNGKPTTVIVIDIKKKFRYIRSRIEKIQKDESFTNRLEPRQLKNPEYWSPEYVLV
CNLKAYFVNKAINMGLVKTPLVAWIDFGYCHKPNVTRGLKIWDFPFDESKMHLFTIKKGL
TVTSQQQVFDFMIGNHVYIIGGAIVGSQHKWKEFYKLVLESQKITLNNNIVDDDQGIFVM
CYYKRPDLFNLNYLGRGKWFDLFRCFRSNTLGAKMQALRIFLSRK