Protein Info for b3586 in Escherichia coli BW25113

Name: yiaV
Annotation: membrane fusion protein (MFP) component of efflux pump, signal anchor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 49 (23 residues), see Phobius details PF00529: CusB_dom_1" amino acids 10 to 367 (358 residues), 39.1 bits, see alignment E=1.2e-13 PF13533: Biotin_lipoyl_2" amino acids 64 to 110 (47 residues), 27.8 bits, see alignment 3.4e-10 PF16576: HlyD_D23" amino acids 164 to 301 (138 residues), 37.7 bits, see alignment E=2.9e-13

Best Hits

Swiss-Prot: 100% identical to YIAV_ECOLI: Inner membrane protein YiaV (yiaV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3586)

Predicted SEED Role

"Multidrug resistance protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37683 at UniProt or InterPro

Protein Sequence (378 amino acids)

>b3586 membrane fusion protein (MFP) component of efflux pump, signal anchor (NCBI) (Escherichia coli BW25113)
MDLLIILTYVAFAWAMFKIFKIPVNKWTIPTAALGGIFIVSGLILLMNYNHPYTFKAQKA
VISIPVVPQVTGVVIEVTDKKNTLIKKGEVLFRLDPTRYQARVDRLMADIVTAEHKQRAL
GAELDEMAANTQQAKATRDKFAKEYQRYARGSQAKVNPFSERDIDVARQNYLAQEASVKS
SAAEQKQIQSQLDSLVLGEHSQIASLKAQLAEAKYNLEQTIVRAPSDGYVTQVLIRPGTY
AASLPLRPVMVFIPDQKRQIVAQFRQNSLLRLAPGDDAEVVFNALPGKVFSGKLAAISPA
VPGGAYQSTGTLQTLNTAPGSDGVIATIELDEHTDLSALPDGIYAQVAVYSDHFSHVSVM
RKVLLRMTSWVHYLYLDH