Protein Info for b3584 in Escherichia coli BW25113

Name: yiaT
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF06629: MipA" amino acids 26 to 246 (221 residues), 178.4 bits, see alignment E=1.2e-56

Best Hits

Swiss-Prot: 100% identical to YIAT_ECOLI: Putative outer membrane protein YiaT (yiaT) from Escherichia coli (strain K12)

KEGG orthology group: K07274, outer membrane protein (inferred from 100% identity to eco:b3584)

MetaCyc: 39% identical to MltA-interacting protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Putative outer membrane protein yiaT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37681 at UniProt or InterPro

Protein Sequence (246 amino acids)

>b3584 hypothetical protein (NCBI) (Escherichia coli BW25113)
MLINRNIVALFALPFMASATASELSIGAGAAYNESPYRGYNENTKAIPLISYEGDTFYVR
QTTLGFILSQSEKNELSLTASWMPLEFDPTDNDDYAMQQLDKRDSTAMAGVAWYHHERWG
TVKASAAADVLDNSNGWVGELSVFHKMQIGRLSLTPALGVLYYDENFSDYYYGISESESR
RSGLASYSAQDAWVPYVSLTAKYPIGEHVVLMASAGYSELPEEITDSPMIDRNESFTFVT
GVSWRF